Recombinant Escherichia coli RPSF Protein (30S) (1-131 aa), GST-tagged
Cat.No. : | RPSF-1225E |
Product Overview : | Recombinant Escherichia coli (strain K12) RPSF Protein (30S) (1-131 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-131 aa |
Description : | Binds together with S18 to 16S ribosomal RNA. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 42.2 kDa |
AA Sequence : | MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | rpsF 30S ribosomal subunit protein S6 [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | RPSF |
Synonyms | ECK4196; sdgH; |
Gene ID | 948723 |
Protein Refseq | NP_418621 |
UniProt ID | P02358 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPSF Products
Required fields are marked with *
My Review for All RPSF Products
Required fields are marked with *
0
Inquiry Basket