Recombinant Escherichia coli RPSC Protein (30S) (2-233 aa), GST-tagged

Cat.No. : RPSC-1227E
Product Overview : Recombinant Escherichia coli (strain K12) RPSC Protein (30S) (2-233 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : GST
Protein Length : 2-233 aa
Description : Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation .Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 52.9 kDa
AA Sequence : GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name rpsC 30S ribosomal subunit protein S3 [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol RPSC
Synonyms ECK3301;
Gene ID 947814
Protein Refseq NP_417773
UniProt ID P0A7V3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RPSC Products

Required fields are marked with *

My Review for All RPSC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon