Recombinant Escherichia coli RPSC Protein (30S) (2-233 aa), GST-tagged

• Cat.No.: RPSC-1227E
• Product Overview: Recombinant Escherichia coli (strain K12) RPSC Protein (30S) (2-233 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: E.coli
• Source: E.coli
• Tag: GST
• ProteinLength: 2-233 aa
• Description: Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation .Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 52.9 kDa
• AA Sequence: GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: rpsC 30S ribosomal subunit protein S3 [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: RPSC
• Synonyms: ECK3301
• Gene ID: 947814
• Protein Refseq: NP_417773
• UniProt ID: P0A7V3