Recombinant Escherichia coli RPMA Protein (50S) (2-85 aa), GST-tagged
Cat.No. : | RPMA-1247E |
Product Overview : | Recombinant Escherichia coli (strain K12) RPMA Protein (50S) (2-85 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-85 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 36.0 kDa |
AA Sequence : | AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | rpmA 50S ribosomal subunit protein L27 [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | RPMA |
Synonyms | ECK3174; rpz; |
Gene ID | 945190 |
Protein Refseq | NP_417652 |
UniProt ID | P0A7L8 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPMA Products
Required fields are marked with *
My Review for All RPMA Products
Required fields are marked with *
0
Inquiry Basket