Recombinant Escherichia coli O157:H7 nudC protein, His-tagged
Cat.No. : | nudC-4443E |
Product Overview : | Recombinant Escherichia coli O157:H7 nudC protein(Q8X6X7)(1-257aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-257aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.8 kDa |
AA Sequence : | MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLIQQQRRYDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKHLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEYE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
NUDC-1706H | Recombinant Human NUDC protein, His & T7-tagged | +Inquiry |
NUDC-3982H | Recombinant Human NUDC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NUDC-11160Z | Recombinant Zebrafish NUDC | +Inquiry |
NUDC-3773R | Recombinant Rat NUDC Protein, His (Fc)-Avi-tagged | +Inquiry |
NUDC-4112R | Recombinant Rat NUDC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDC-3658HCL | Recombinant Human NUDC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nudC Products
Required fields are marked with *
My Review for All nudC Products
Required fields are marked with *
0
Inquiry Basket