Recombinant Escherichia coli NIKR Protein (1-133 aa), His-tagged

Cat.No. : NIKR-2357E
Product Overview : Recombinant Escherichia coli (strain K12) NIKR Protein (1-133 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Protein Length : 1-133 aa
Description : Transcriptional repressor of the nikABCDE operon. Is active in the presence of excessive concentrations of intracellular nickel.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 19.1 kDa
AA Sequence : MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name nikR DNA-binding transcriptional repressor NikR [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol NIKR
Synonyms nikR; ECK3465; yhhG;
Gene ID 947995
Protein Refseq NP_417938
UniProt ID P0A6Z6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NIKR Products

Required fields are marked with *

My Review for All NIKR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon