Recombinant Escherichia coli NIKR Protein (1-133 aa), His-tagged

• Cat.No.: NIKR-2357E
• Product Overview: Recombinant Escherichia coli (strain K12) NIKR Protein (1-133 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His
• ProteinLength: 1-133 aa
• Description: Transcriptional repressor of the nikABCDE operon. Is active in the presence of excessive concentrations of intracellular nickel.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 19.1 kDa
• AA Sequence: MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: nikR DNA-binding transcriptional repressor NikR [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: NIKR
• Synonyms: nikR; ECK3465; yhhG
• Gene ID: 947995
• Protein Refseq: NP_417938
• UniProt ID: P0A6Z6