Recombinant Escherichia coli MRCB Protein (444-736 aa), His-Myc-tagged

• Cat.No.: MRCB-2528E
• Product Overview: Recombinant Escherichia coli (strain K12) MRCB Protein (444-736 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His&Myc
• Protein Length: 444-736 aa
• Description: Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 38.6 kDa
• AA Sequence: SVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: mrcB peptidoglycan glycosyltransferase/peptidoglycan DD-transpeptidase MrcB [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: MRCB
• Synonyms: mrcB; ECK0148; pbpF; ponB
• Gene ID: 944843
• Protein Refseq: NP_414691
• UniProt ID: P02919