Recombinant Escherichia coli ISPU Protein (1-253 aa), His-tagged

Cat.No. : ISPU-2369E
Product Overview : Recombinant Escherichia coli (strain K12) ISPU Protein (1-253 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Protein Length : 1-253 aa
Description : Generates ditrans,octacis-undecaprenyl pyrophosphate (UPP) from isopentenyl pyrophosphate (IPP) and farnesyl diphosphate (FPP). UPP is the precursor of glycosyl carrier lipid in the biosynthesis of bacterial cell wall polysaccharide components such as peptidoglycan and lipopolysaccharide.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 32.4 kDa
AA Sequence : MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGTEPGDETA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name ispU undecaprenyl diphosphate synthase [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol ISPU
Synonyms ispU; ECK0173; rth; uppS; yaeS;
Gene ID 944874
Protein Refseq NP_414716
UniProt ID P60472

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ISPU Products

Required fields are marked with *

My Review for All ISPU Products

Required fields are marked with *

0

Inquiry Basket

cartIcon