Recombinant Escherichia coli GLPE Protein (1-108 aa), His-tagged

Cat.No. : GLPE-2106E
Product Overview : Recombinant Escherichia coli (strain ATCC 8739/DSM 1576/Crooks) GLPE Protein (1-108 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Protein Length : 1-108 aa
Description : Catalyzes, although with low efficiency, the sulfur transfer reaction from thiosulfate to cyanide.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 16.1 kDa
AA Sequence : MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEVWQRQFPAEVAYGA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms glpE;
UniProt ID B1IP41

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GLPE Products

Required fields are marked with *

My Review for All GLPE Products

Required fields are marked with *

0

Inquiry Basket

cartIcon