Recombinant Escherichia coli GHRA Protein (1-312 aa), His-SUMO-tagged
Cat.No. : | GHRA-2180E |
Product Overview : | Recombinant Escherichia coli (strain 55989/EAEC) GHRA Protein (1-312 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-312 aa |
Description : | Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 51.4 kDa |
AA Sequence : | MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | ghrA; 2-ketoacid reductase; |
UniProt ID | B7LFE3 |
◆ Recombinant Proteins | ||
GHRA-2180E | Recombinant Escherichia coli GHRA Protein (1-312 aa), His-SUMO-tagged | +Inquiry |
ghrA-4302E | Recombinant Escherichia coli ghrA protein | +Inquiry |
GHRA-5430Z | Recombinant Zebrafish GHRA | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GHRA Products
Required fields are marked with *
My Review for All GHRA Products
Required fields are marked with *
0
Inquiry Basket