Recombinant Escherichia coli FANC Protein (23-181 aa)

• Cat.No.: FANC-2181E
• Product Overview: Recombinant Escherichia coli FANC Protein (23-181 aa) is produced by E. coli expression system. Protein Description: Full Length of Mature Protein.

Specification

• Species: E.coli
• Source: E.coli
• Tag: Non
• ProteinLength: 23-181 aa
• Description: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. FanC is the main component of the K99 fimbriae.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.5 kDa
• AA Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: fanC
• UniProt ID: P18103