Recombinant Escherichia coli ELTB Protein (22-124 aa), His-tagged

• Cat.No.: ELTB-2353E
• Product Overview: Recombinant Escherichia coli ELTB Protein (22-124 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal and C-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His
• Protein Length: 22-124 aa
• Description: The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 17 kDa
• AA Sequence: APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: eltB heat-labile enterotoxin B subunit [ Escherichia coli ETEC H10407 ]
• Official Symbol: ELTB
• Synonyms: eltB
• Gene ID: 8571464
• UniProt ID: P0CK94