Recombinant Escherichia coli ECORVM Protein (1-298 aa), His-SUMO-tagged
Cat.No. : | ECORVM-2358E |
Product Overview : | Recombinant Escherichia coli ECORVM Protein (1-298 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-298 aa |
Description : | This methylase recognizes the double-stranded sequence GATATC, causes specific methylation on A-2 on both strands, and protects the DNA from cleavage by the EcoRV endonuclease. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 50.6 kDa |
AA Sequence : | MKDKVFVPPIKSQGIKTKLVPCIKRIVPKNFNGVWVEPFMGTGVVAFNVAPKDALLCDTNPHLISFYNALKNKDITGDLVKDFLYREGEKLLLSNGEYYYEVRERFNNYKEPLDFLFLNRSCFNGMIRFNSKGGFNVPFCKKPNRFAQAYITKISNQVDRISEIISKGNYTFLCQSFEKTIGMVNRDDVVYCDPPYIGRHVDYFNSWGERDERLLFETLSSLNATFITSTWHHNDYRENKYVRDLWSSFRILTKEHFYHVGASEKNRSPMVEALITNIAKDIIDHIEKSSGDILVIEE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | ecoRVM MEcoRV [ Escherichia coli ] |
Official Symbol | ECORVM |
Synonyms | ecoRVM; |
Gene ID | 1446622 |
Protein Refseq | NP_863581 |
UniProt ID | P04393 |
◆ Recombinant Proteins | ||
ECORVM-2358E | Recombinant Escherichia coli ECORVM Protein (1-298 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECORVM Products
Required fields are marked with *
My Review for All ECORVM Products
Required fields are marked with *
0
Inquiry Basket