Recombinant Escherichia coli CDTB Protein (19-269 aa), His-SUMO-Myc-tagged

• Cat.No.: CDTB-2179E
• Product Overview: Recombinant Escherichia coli CDTB Protein (19-269 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His&Myc&SUMO
• ProteinLength: 19-269 aa
• Description: Part of the tripartite complex that is required for the CDT activity. CdtB exhibits a DNA-nicking endonuclease activity, and very probably causes DNA damage in intoxicated cells. This damage induces G2/M cell cycle arrest, chromatin fragmentation, cell distention and nucleus enlargement.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 47.4 kDa
• AA Sequence: DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: cdtB type III cytolethal distending toxin protein CdtB [ Escherichia coli Vir68 ]
• Official Symbol: CDTB
• Synonyms: cdtB
• Gene ID: 8164729
• UniProt ID: Q46669