Recombinant Escherichia coli BTUF Protein (24-266 aa), GST-tagged

• Cat.No.: BTUF-1263E
• Product Overview: Recombinant Escherichia coli (strain K12) BTUF Protein (24-266 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: E.coli
• Source: E.coli
• Tag: GST
• Protein Length: 24-266 aa
• Description: Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Binds vitamin B12 and delivers it to the periplasmic surface of BtuC.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 53.9 kDa
• AA Sequence: PRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: btuF vitamin B12 ABC transporter periplasmic binding protein [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: BTUF
• Synonyms: ECK0157; yadT
• Gene ID: 947574
• Protein Refseq: NP_414700
• UniProt ID: P37028