Recombinant Enterobacteria phage MS2 Capsid Protein, His/Myc-tagged

Cat.No. : Capsid-01E
Product Overview : Recombinant full length Enterobacteria phage MS2 Capsid Protein (2-130aa) with N-terminal 10xHis-tagged and C-terminal Myc-tagged o was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Enterobacteria phage MS2
Source : E.coli
Tag : His&Myc
Protein Length : 2-130aa
Description : Capsid protein self-assembles to form an icosahedral capsid with a T=3 symmetry, about 26 nm in diameter, and consisting of 89 capsid proteins dimers (178 capsid proteins).
Form : Liquid or Lyophilized powder
Molecular Mass : 21.2 kDa
AA Sequence : ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Purity : > 85% as determined by SDS-PAGE.
Stability : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20/-80 centigrade. The shelf life of lyophilized form is 12 months at -20/-80 centigrade.
Storage : Store at -20/-80 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Official Symbol CP
Synonyms Capsid protein; CP; Coat protein
UniProt ID P03612

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Capsid Products

Required fields are marked with *

My Review for All Capsid Products

Required fields are marked with *

0

Inquiry Basket

cartIcon