Recombinant Enterobacteria phage MS2 Capsid Protein, His/Myc-tagged

• Cat.No.: Capsid-01E
• Product Overview: Recombinant full length Enterobacteria phage MS2 Capsid Protein (2-130aa) with N-terminal 10xHis-tagged and C-terminal Myc-tagged o was expressed in E. coli.

Specification

• Species: Enterobacteria phage MS2
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 2-130aa
• Description: Capsid protein self-assembles to form an icosahedral capsid with a T=3 symmetry, about 26 nm in diameter, and consisting of 89 capsid proteins dimers (178 capsid proteins).
• Form: Liquid or Lyophilized powder
• Molecular Mass: 21.2 kDa
• AA Sequence: ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY
  Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
• Purity: > 85% as determined by SDS-PAGE.
• Stability: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20/-80 centigrade. The shelf life of lyophilized form is 12 months at -20/-80 centigrade.
• Storage: Store at -20/-80 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  Note: If you have any special requirement for the glycerol content, please remark when you place the order.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Official Symbol: CP
• Synonyms: Capsid protein; CP; Coat protein
• UniProt ID: P03612