Recombinant E. coli yebF Protein, His/MYC-tagged

• Cat.No.: yebF-1052E
• Product Overview: Recombinant E. coli yebF Protein (22-118aa) was expressed in E. coli with N-terminal His and C-terminal MYC tag.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His&Myc
• Protein Length: 22-118 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 15.8 kDa
• AA Sequence: ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPL
  TVRGKSADIHYQVSVDCKAGMAEYQRR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: yebF extracellular Colicin M immunity family protein [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: yebF
• Synonyms: ECK1848; JW1836
• Gene ID: 946363
• Protein Refseq: NP_416361.2
• UniProt ID: P33219