Recombinant E. coli peptide deformylase
Cat.No. : | def-01E |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | Non |
Form : | 20 mM Tris-HCl, 200 mM NaCl, pH7.4, 5% Trehalose |
Molecular Mass : | Theoretical Mol Wt: ~20 kDa |
AA Sequence : | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLIN PELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPL KQQRIRQKVEKLDRLKARA |
Purity : | >95% as determined by SDS-PAGE |
Storage : | Short Term Storage at +4°C, Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles. |
Reconstitution : | It is recommended to reconstitute the lyophilized PDF in sterile and pre-cooled ddH2O not less than 0.1mg/ml, which can then be further diluted to other aqueous solutions. |
◆ Native Proteins | ||
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
FGA-6H | Native Human Fibrinogen Protein, Alexa Fluor 488 labeled | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
CRP-8057H | Native C-Reactive Protein | +Inquiry |
HB-43R | Native Rat Hemoglobin (HB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
IGSF21-5256HCL | Recombinant Human IGSF21 293 Cell Lysate | +Inquiry |
ITGAV-877HCL | Recombinant Human ITGAV cell lysate | +Inquiry |
MMAA-4286HCL | Recombinant Human MMAA 293 Cell Lysate | +Inquiry |
APOL2-8778HCL | Recombinant Human APOL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All def Products
Required fields are marked with *
My Review for All def Products
Required fields are marked with *
0
Inquiry Basket