Recombinant E. coli ompC Protein, His-SUMO-tagged

Cat.No. : ompC-1311E
Product Overview : Recombinant E. coli ompC Protein (22-367aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His&SUMO
Protein Length : 22-367 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 54.3 kDa
AA Sequence : AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name ompC outer membrane porin protein C [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol ompC
Synonyms butR; ECK2207; JW2203; meoA; par
Gene ID 946716
Protein Refseq NP_416719.1
UniProt ID P06996

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ompC Products

Required fields are marked with *

My Review for All ompC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon