Recombinant E. coli mppA Protein, His-SUMO-tagged
Cat.No. : | mppA-1285E |
Product Overview : | Recombinant E. coli (strain K12) mppA Protein (23-537aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 23-537 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 73.6 kDa |
AA Sequence : | AEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQVIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQKGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEELNAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | mppA murein tripeptide (L-ala-gamma-D-glutamyl-meso-DAP) transporter subunit [ Escherichia coli str. K-12 substr. MG1655 ]; ynaH |
Official Symbol | mppA |
Synonyms | mppA; Periplasmic murein peptide-binding protein |
Gene ID | 945951 |
Protein Refseq | NP_415845.2 |
UniProt ID | P77348 |
◆ Recombinant Proteins | ||
mppA-1285E | Recombinant E. coli mppA Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mppA Products
Required fields are marked with *
My Review for All mppA Products
Required fields are marked with *
0
Inquiry Basket