Recombinant E. coli Glyoxylate/hydroxypyruvate reductase A Protein, His-SUMO-tagged

Cat.No. : ghrA-1227E
Product Overview : Recombinant E. coli (strain 55989 / EAEC) Glyoxylate/hydroxypyruvate reductase A Protein (1-312aa) was expressed in E. coli with N-terminal His-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His&SUMO
Protein Length : 1-312 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 51.4 kDa
AA Sequence : MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Glyoxylate/hydroxypyruvate reductase A
Official Symbol Glyoxylate/hydroxypyruvate reductase A
Synonyms Glyoxylate/hydroxypyruvate reductase A; EC 1.1.1.79; EC 1.1.1.81; 2-ketoacid reductase; ghrA
UniProt ID B7LFE3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Glyoxylate/hydroxypyruvate reductase A Products

Required fields are marked with *

My Review for All Glyoxylate/hydroxypyruvate reductase A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon