Recombinant E. coli fur Protein

• Cat.No.: fur-4552E
• Product Overview: Escherichia coli fur (NP_415209, 1 a.a. - 148 a.a.) full-length recombinant protein expressed in Escherichia coli.

Specification

• Species: E.coli
• Source: E.coli
• Tag: Non
• Description: Fur translation in coupled to the translation of the upstream leader pepidie Uof; Uof translation is inhibited by the antisense sRNA ryhB; Uof translation opens up a hairpin that blocks Fur translation (Vecerek, 2007). [More information is available at EcoGene: EG10359].
• Form: Liquid
• Molecular Mass: 42 kDa
• AA Sequence: MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 1 mg/mL
• Storage Buffer: In 20 mM Tris, 2 mM CaCl2, 100mM NaCl, pH 8.0

Gene Information

• Gene Name: fur ferric iron uptake regulon transcriptional repressor; autorepressor [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: fur
• Synonyms: fur; ferric iron uptake regulon transcriptional repressor; autorepressor; ECK0671; JW0669; ferric iron uptake regulon transcriptional repressor; autorepressor; NP_415209.1; negative regulator
• Gene ID: 945295