Recombinant E. coli fimA Protein, His-SUMO-tagged

Cat.No. : fimA-1214E
Product Overview : Recombinant E. coli (strain K12) fimA Protein (24-182aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His&SUMO
Protein Length : 24-182 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 31.8 kDa
AA Sequence : AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAA
VAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFAT
GAATPGAANADATFKVQYQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name fimA major type 1 subunit fimbrin (pilin) [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol fimA
Synonyms ECK4305; fimD; JW4277; pilA; fimA; major type 1 subunit fimbrin (pilin); Type-1A pilin
Gene ID 948838
Protein Refseq NP_418734.1
UniProt ID P04128

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All fimA Products

Required fields are marked with *

My Review for All fimA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon