Recombinant E. coli fimA Protein, His-SUMO-tagged
Cat.No. : | fimA-1214E |
Product Overview : | Recombinant E. coli (strain K12) fimA Protein (24-182aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-182 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 31.8 kDa |
AA Sequence : | AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAA VAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFAT GAATPGAANADATFKVQYQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | fimA major type 1 subunit fimbrin (pilin) [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | fimA |
Synonyms | ECK4305; fimD; JW4277; pilA; fimA; major type 1 subunit fimbrin (pilin); Type-1A pilin |
Gene ID | 948838 |
Protein Refseq | NP_418734.1 |
UniProt ID | P04128 |
◆ Recombinant Proteins | ||
fimA-4297P | Recombinant Porphyromonas gingivalis fimA protein, His&Myc-tagged | +Inquiry |
fimA-1214E | Recombinant E. coli fimA Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fimA Products
Required fields are marked with *
My Review for All fimA Products
Required fields are marked with *
0
Inquiry Basket