Recombinant E. coli ECs4214 Protein, His-SUMO-tagged
Cat.No. : | ECs4214-1338E |
Product Overview : | Recombinant E. coli ECs4214 Protein (25-190aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 25-190 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 34.1 kDa |
AA Sequence : | AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPN PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQ VPTHDVGPYQNVPSKPVVILSAKVLP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | ECs4214 peptidyl-prolyl cis-trans isomerase A [ Escherichia coli O157:H7 str. Sakai ] |
Official Symbol | ECs4214 |
Synonyms | peptidyl-prolyl cis-trans isomerase A; ECs4214; ppiA; EC 5.2.1.8; PPIase A; Cyclophilin A; Rotamase A |
Gene ID | 915930 |
Protein Refseq | NP_312241.1 |
UniProt ID | P0AFL5 |
◆ Recombinant Proteins | ||
CCL4-137C | Recombinant Chicken Chemokine (C-C motif) Ligand 4 | +Inquiry |
YOZW-3464B | Recombinant Bacillus subtilis YOZW protein, His-tagged | +Inquiry |
CHGA-20HFL | Recombinant Human CHGA Protein, Full Length, C-His tagged | +Inquiry |
CRESTIN-8628Z | Recombinant Zebrafish CRESTIN | +Inquiry |
YHAJ-3326B | Recombinant Bacillus subtilis YHAJ protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
TRPM2-8450H | Native Human TRPM2 | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
ALB-03C | Native Cynomolgus Monkey ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT2A-4096HCL | Recombinant Human MT2A 293 Cell Lysate | +Inquiry |
IRF1-5168HCL | Recombinant Human IRF1 293 Cell Lysate | +Inquiry |
C1orf189-8169HCL | Recombinant Human C1orf189 293 Cell Lysate | +Inquiry |
PUF60-2665HCL | Recombinant Human PUF60 293 Cell Lysate | +Inquiry |
ES-D3-573M | ES-D3 (mouse pluripotent embryonic stem cell) whole cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ECs4214 Products
Required fields are marked with *
My Review for All ECs4214 Products
Required fields are marked with *
0
Inquiry Basket