Recombinant E. coli DNA-binding protein HU-alpha Protein, His-SUMO-tagged
| Cat.No. : | hupA-1248E |
| Product Overview : | Recombinant E. coli (O157:H7) DNA-binding protein HU-alpha Protein (1-90aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His&SUMO |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 25.5 kDa |
| AA Sequence : | MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIK IAAANVPAFVSGKALKDAVK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | DNA-binding protein HU-alpha |
| Official Symbol | DNA-binding protein HU-alpha |
| Synonyms | DNA-binding protein HU-alpha; transcriptional regulator HU subunit alpha; ECs4923; hupA; HU-2 NS2 |
| UniProt ID | P0ACF2 |
| ◆ Recombinant Proteins | ||
| TTC36-17567M | Recombinant Mouse TTC36 Protein | +Inquiry |
| S-2011S | Active Recombinant SARS-CoV-2 B.1.617.2 Spike Protein, His-tagged, Alexa Fluor® 647 conjugated | +Inquiry |
| ERBB2-1216CAF488 | Recombinant Monkey ERBB2 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| Cerkl-2120M | Recombinant Mouse Cerkl Protein, Myc/DDK-tagged | +Inquiry |
| USP24-9954M | Recombinant Mouse USP24 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| Lectin-1811N | Active Native Narcissus Pseudonarcissus Lectin Protein, Biotinylated | +Inquiry |
| Ferrous Hemoglobin-033H | Native Human Ferrous Hemoglobin Protein | +Inquiry |
| Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
| AFP-412H | Native Human AFP Protein | +Inquiry |
| HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PGS1-3246HCL | Recombinant Human PGS1 293 Cell Lysate | +Inquiry |
| IGBP1-5269HCL | Recombinant Human IGBP1 293 Cell Lysate | +Inquiry |
| ULK3-1883HCL | Recombinant Human ULK3 cell lysate | +Inquiry |
| PGA4-1754HCL | Recombinant Human PGA4 cell lysate | +Inquiry |
| ICOSLG-1095HCL | Recombinant Human ICOSLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNA-binding protein HU-alpha Products
Required fields are marked with *
My Review for All DNA-binding protein HU-alpha Products
Required fields are marked with *
0
Inquiry Basket
