Recombinant E. coli DNA-binding protein HU-alpha Protein, His-SUMO-tagged
| Cat.No. : | hupA-1248E |
| Product Overview : | Recombinant E. coli (O157:H7) DNA-binding protein HU-alpha Protein (1-90aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His&SUMO |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 25.5 kDa |
| AA Sequence : | MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIK IAAANVPAFVSGKALKDAVK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | DNA-binding protein HU-alpha |
| Official Symbol | DNA-binding protein HU-alpha |
| Synonyms | DNA-binding protein HU-alpha; transcriptional regulator HU subunit alpha; ECs4923; hupA; HU-2 NS2 |
| UniProt ID | P0ACF2 |
| ◆ Recombinant Proteins | ||
| hupA-1248E | Recombinant E. coli DNA-binding protein HU-alpha Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNA-binding protein HU-alpha Products
Required fields are marked with *
My Review for All DNA-binding protein HU-alpha Products
Required fields are marked with *
0
Inquiry Basket
