Recombinant E. coli CS6 fimbrial subunit B Protein, His-SUMO-tagged
| Cat.No. : | cssB-1173E |
| Product Overview : | Recombinant E. coli (K12) CS6 fimbrial subunit B Protein (22-167aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 22-167 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 31.9 kDa |
| AA Sequence : | GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQ QIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLT VSFYSN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | CS6 fimbrial subunit B |
| Official Symbol | CS6 fimbrial subunit B |
| Synonyms | CS6 fimbrial subunit B; cssB; |
| UniProt ID | P53510 |
| ◆ Recombinant Proteins | ||
| cssB-1173E | Recombinant E. coli CS6 fimbrial subunit B Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CS6 fimbrial subunit B Products
Required fields are marked with *
My Review for All CS6 fimbrial subunit B Products
Required fields are marked with *
0
Inquiry Basket
