Recombinant Drosophila Melanogaster Trithorax-Like

• Cat.No.: Trl-4370D
• Product Overview: GAGA-POZ Drosophila Melanogaster Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 130 amino acids & having a molecular mass of 14 kDa.

Specification

• Species: Drosophila
• Source: Drosophila Melanogaster
• Tag: Non
• Description: The GAGA factor is a sequence-specific DNA-binding protein, which participates in the regulation of the expression of a variety of different classes of genes in Drosophila such as many developmentally regulated genes, stress induced genes, and cell cycle regulated genes, as well as housekeeping genes. GAGA contains a C-terminal glutamine-rich domain and a highly conserved N-terminal POZ domain which reported to be involved in self-oligomerization in a number of other POZ domain containing proteins. In case of GAGA protein, the N-terminal POZ domain mediates the formation of oligomers both in vitro and in vivo.
• Form: The protein containing 10mM HEPES (pH-7.4) and 25mM NaCl.
• Purity: Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE; Sterile filtered colorless solution.
• Physical Appearance: Sterile filtered colorless solution.
• Amino Acid Sequence: MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGR SFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALL EFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH
• Storage: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
• Functions: DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding

Gene Information

• Gene Name: Trl Trithorax-like [ Drosophila melanogaster ]
• Official Symbol: Trl
• Synonyms: trl; Adf-2; Adf-2-519; Adf2; anon-EST:fe2E12; CG- 33261; CG9343; Dmel\CG33261; E(var)3-trl; E(var)62; Gaf; GAF; gaga; Gaga; GAGA; l(3)s2325; Nc70F; NC70F; TfGA- GA/Adf-2; TRL; Trl-GAGA
• Gene ID: 2768981
• mRNA Refseq: NM_001038926
• Protein Refseq: NP_001034015
• MIM: 605125
• UniProt ID: Q2PDY2
• Chromosome Location: 70F4-70F4