Recombinant Dog SPP1 protein, His-tagged

Cat.No. : SPP1-7901D
Product Overview : Recombinant Dog SPP1 protein(Ile7~Ser232), fused with N-terminal His tag, was expressed in E. coli.
Availability March 14, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Ile7~Ser232
Tag : N-His
Form : Lyophilized from sterile PBS, pH7.4, 5% Trehalose, 5% Manitol
Molecular Mass : The protein has a calculated MW of 26 kDa.
Endotoxin : <0.01EU/ug by LAL.
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.07mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MHHHHHHHHHHIAYAIPIKHADSGSSEEKQNAVLTEETDDFKQKTFSSKSNESHDDVDEDDGDDVDSQDSVDSNDLDDDSNESDESDELVTDFPTDIPATQLFTPAVPTRGSYDGRGDSVAYGLRSKSKKSHKYEVQYPDSTEEDFTSLVKSASMEDDFNAVLLSRTVRGTSDRDSHAKDSQETSQLDDHSMETKDRKHSQEYKLRASDESNMHSHEIGSQENSEVSSELVSQLSQS
Gene Name SPP1 secreted phosphoprotein 1 [ Canis lupus familiaris ]
Official Symbol SPP1
Synonyms SPP1; secreted phosphoprotein 1; osteopontin; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1);
Gene ID 478471

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ABI2 Products

Required fields are marked with *

My Review for All ABI2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon