Recombinant Dog SPP1 protein, His-tagged

• Cat.No.: SPP1-7901D
• Product Overview: Recombinant Dog SPP1 protein(Ile7~Ser232), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: Ile7~Ser232
• Tag: N-His
• Form: Lyophilized from sterile PBS, pH7.4, 5% Trehalose, 5% Manitol
• Molecular Mass: The protein has a calculated MW of 26 kDa.
• AASequence: MHHHHHHHHHHIAYAIPIKHADSGSSEEKQNAVLTEETDDFKQKTFSSKSNESHDDVDEDDGDDVDSQDSVDSNDLDDDSNESDESDELVTDFPTDIPATQLFTPAVPTRGSYDGRGDSVAYGLRSKSKKSHKYEVQYPDSTEEDFTSLVKSASMEDDFNAVLLSRTVRGTSDRDSHAKDSQETSQLDDHSMETKDRKHSQEYKLRASDESNMHSHEIGSQENSEVSSELVSQLSQS
• Endotoxin: <0.01EU/ug by LAL.
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.07mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SPP1 secreted phosphoprotein 1 [ Canis lupus familiaris ]
• Official Symbol: SPP1
• Synonyms: SPP1; secreted phosphoprotein 1; osteopontin; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1)
• Gene ID: 478471