Recombinant Dog LHB protein, His-tagged
Cat.No. : | LHB-3173D |
Product Overview : | Recombinant Dog LHB protein(P18842)(18-138aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-138aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.8 kDa |
AA Sequence : | SRGPLRPLCRPINATLAAENEACPVCITFTTTICAGYCPSMVRVLPAALPPVPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQSLACDRPLLPGLLFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LHB luteinizing hormone beta polypeptide [ Canis lupus familiaris ] |
Official Symbol | LHB |
Synonyms | LHB; luteinizing hormone beta polypeptide; lutropin subunit beta; LSH-beta; lutropin beta chain; luteinizing hormone subunit beta; LH; LH-B; LSH-B; |
Gene ID | 403959 |
mRNA Refseq | NM_001197033 |
Protein Refseq | NP_001183962 |
◆ Recombinant Proteins | ||
lhb-2739Z | Recombinant Zebrafish lhb Protein, His-tagged | +Inquiry |
LHB-622B | Recombinant Bovine LHB Protein (21-141 aa), His-tagged | +Inquiry |
LHB-11657Z | Recombinant Zebrafish LHB | +Inquiry |
LHB-652C | Recombinant Cynomolgus LHB Protein, His-tagged | +Inquiry |
LHB-3173D | Recombinant Dog LHB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LHB-8212H | Native Luteinizing Beta Subunit Hormone | +Inquiry |
LHB-840 | Native Luteinizing Hormone, beta Subunit | +Inquiry |
◆ Cell & Tissue Lysates | ||
LHB-1522HCL | Recombinant Human LHB Overexpression Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LHB Products
Required fields are marked with *
My Review for All LHB Products
Required fields are marked with *
0
Inquiry Basket