Recombinant Dog CALCA protein, His-SUMO-tagged

• Cat.No.: CALCA-2620D
• Product Overview: Recombinant Dog CALCA protein(P41547)(85-116aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Dog
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.4 kDa
• Protein length: 85-116aa
• AA Sequence: CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CALCA calcitonin-related polypeptide alpha [ Canis lupus familiaris ]
• Official Symbol: CALCA
• Synonyms: CALCA; calcitonin-related polypeptide alpha; calcitonin; calcitonin/calcitonin-related polypeptide, alpha
• Gene ID: 403946
• mRNA Refseq: NM_001003266
• Protein Refseq: NP_001003266