Recombinant Human CALCA Protein, His-tagged

• Cat.No.: CALCA-817H
• Product Overview: Recombinant Human CALCA, transcript variant 2, fused with His tag at C-terminal was expressed in E. coli.

Specification

• Description: This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
• Molecular Mass: 10.5kD
• AA Sequence: YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANVEHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: CALCA calcitonin-related polypeptide alpha [ Homo sapiens ]
• Official Symbol: CALCA
• Synonyms: CALCA; calcitonin-related polypeptide alpha; CALC1, calcitonin 1; calcitonin; calcitonin gene-related peptide 1; calcitonin; katacalcin; calcitonin 1; alpha-type CGRP; calcitonin gene-related peptide I; calcitonin/calcitonin-related polypeptide, alpha; CT; KC; CGRP; CALC1; CGRP1; CGRP-I; MGC126648
• Gene ID: 796
• mRNA Refseq: NM_001033952
• Protein Refseq: NP_001029124
• MIM: 114130
• UniProt ID: P01258