Recombinant Daboia palaestinae Disintegrin viperistatin, His-Myc-tagged

• Cat.No.: viperistatin-576D
• Product Overview: Recombinant Daboia palaestinae Disintegrin viperistatin(P0C6E2)(1-41aa), fused with C-terminal His and Myc tag, was expressed in Yeast.

Specification

• Species: Daboia palaestinae
• Source: Yeast
• Tag: C-His-Myc
• ProteinLength: 1-41aa
• Tag: C-His-Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 8.2 kDa
• AASequence: CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.