Recombinant D-xylose reductase Protein, N-His tagged

Cat.No. : D-xylose reductase-43
Product Overview : Recombinant D-xylose reductase Protein with N-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Tag : His
Molecular Mass : 39 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMSTTPTIPTIKLNSGYEMPLVGFGCWKVTNATAADQIYNAIKTGYRLFDGAEDYGNEKEVGEGINRAIKEGLVKREELFITSKLWNNFHDPKNVETALNKTLSDLNLDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGDNFHYEDVPLLDTWKALEKLVEAGKIKSIGISNFTGALIYDLIRGATIKPAVLQIEHHPYLQQPKLIEYVQKAGIAITGYSSFGPQSFLELESKRALNTPTLFEHETIKLIADKHGKSPAQVLLRWATQRNIAVIPKSNNPERLAQNLSVVDFDLTKDDLDNIAKLDIGLRFNDPWDWDNIPIFV
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.23 mg/mL by BCA
Storage Buffer : 25mM Tris, 100mM glycine, pH 7.3, 10% Glycerol
Official Symbol D-xylose reductase
Synonyms D-xylose reductase

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All D-xylose reductase Products

Required fields are marked with *

My Review for All D-xylose reductase Products

Required fields are marked with *

0

Inquiry Basket

cartIcon