Recombinant D-xylose reductase Protein, N-His tagged
Cat.No. : | D-xylose reductase-43 |
Product Overview : | Recombinant D-xylose reductase Protein with N-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Tag : | His |
Molecular Mass : | 39 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMSTTPTIPTIKLNSGYEMPLVGFGCWKVTNATAADQIYNAIKTGYRLFDGAEDYGNEKEVGEGINRAIKEGLVKREELFITSKLWNNFHDPKNVETALNKTLSDLNLDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGDNFHYEDVPLLDTWKALEKLVEAGKIKSIGISNFTGALIYDLIRGATIKPAVLQIEHHPYLQQPKLIEYVQKAGIAITGYSSFGPQSFLELESKRALNTPTLFEHETIKLIADKHGKSPAQVLLRWATQRNIAVIPKSNNPERLAQNLSVVDFDLTKDDLDNIAKLDIGLRFNDPWDWDNIPIFV |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.23 mg/mL by BCA |
Storage Buffer : | 25mM Tris, 100mM glycine, pH 7.3, 10% Glycerol |
Official Symbol | D-xylose reductase |
Synonyms | D-xylose reductase |
◆ Recombinant Proteins | ||
RFL33497YF | Recombinant Full Length Protein Aaex(Aaex) Protein, His-Tagged | +Inquiry |
FAXDC2-0090H | Recombinant Human FAXDC2 Protein, GST-Tagged | +Inquiry |
C9orf57-2717HF | Recombinant Full Length Human C9orf57 Protein | +Inquiry |
GAS2-301350H | Recombinant Human GAS2 protein, GST-tagged | +Inquiry |
RFL35009GF | Recombinant Full Length Glycine Max Casp-Like Protein 7 Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
Immunoglobulin M-85H | Native Human Immunoglobulin M | +Inquiry |
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
ATF-177D | Native Dog Apotransferrin | +Inquiry |
Hp-194R | Native Rat Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC27A6-1747HCL | Recombinant Human SLC27A6 293 Cell Lysate | +Inquiry |
GLI1-5905HCL | Recombinant Human GLI1 293 Cell Lysate | +Inquiry |
EPHA2-2138MCL | Recombinant Mouse EPHA2 cell lysate | +Inquiry |
PPM1N-652HCL | Recombinant Human PPM1N cell lysate | +Inquiry |
APOBEC3G-8784HCL | Recombinant Human APOBEC3G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All D-xylose reductase Products
Required fields are marked with *
My Review for All D-xylose reductase Products
Required fields are marked with *
0
Inquiry Basket