Recombinant D. merckii DEF1 Protein, His-B2M-tagged

• Cat.No.: DEF1-1185D
• Product Overview: Recombinant Human DEF1 Protein (1-50aa) was expressed in E. coli with N-terminal 6xHis-B2M-tag.

Specification

• Species: D.merckii
• Source: E.coli
• Tag: His&B2M
• ProteinLength: 1-50 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 19.5 kDa
• AA Sequence: ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Defensin-like protein 1
• Official Symbol: Defensin-like protein 1
• Synonyms: Defensin-like protein 1; Cysteine-rich antimicrobial protein 1; Defensin AMP1; DmAMP1
• UniProt ID: P0C8Y4