Recombinant D. merckii DEF1 Protein, His-B2M-tagged

Cat.No. : DEF1-1185D
Product Overview : Recombinant Human DEF1 Protein (1-50aa) was expressed in E. coli with N-terminal 6xHis-B2M-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : D.merckii
Source : E.coli
Tag : His&B2M
ProteinLength : 1-50 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 19.5 kDa
AA Sequence : ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Defensin-like protein 1
Official Symbol Defensin-like protein 1
Synonyms Defensin-like protein 1; Cysteine-rich antimicrobial protein 1; Defensin AMP1; DmAMP1
UniProt ID P0C8Y4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Defensin-like protein 1 Products

Required fields are marked with *

My Review for All Defensin-like protein 1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon