Recombinant Cynomolgus SOD1 Protein, His-tagged

• Cat.No.: SOD1-957C
• Product Overview: Recombinant Cynomolgus SOD1 protein with a His-tag was expressed in HEK293

Specification

• Description: Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
• Source: HEK293
• Species: Cynomolgus
• Tag: His
• Molecular Mass: The protein has a calculated MW of 16.7 kDa.
• AA Sequence: AMKAVCVLKGDSPVQGTINFEQKESNGPVKVWGSITGLTEGLHGFHVHQFGDNTQGCTSAGPHFNPLSRQHGGPKDEERHVGDLGNVTAGKDGVAKVSFEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESKKTGNAGGRLACGVIGIAQHHHHHH
• Endotoxin: <1 EU/μg
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.24 mg/mL
• Storage Buffer: PBS, pH 7.4

Gene Information

• Gene Name: SOD1 superoxide dismutase 1, soluble [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: SOD1
• Synonyms: SOD1; superoxide dismutase 1, soluble; superoxide dismutase [Cu-Zn]; Cu,Zn-superoxide dismutase; superoxide dismutase 1, soluble (amyotrophic lateral sclerosis 1 (adult))
• Gene ID: 574096
• mRNA Refseq: NM_001032804
• Protein Refseq: NP_001027976
• UniProt ID: Q8HXQ1