Recombinant Zebrafish sod1 Protein, His-SUMO/MYC-tagged

Cat.No. : sod1-1373Z
Product Overview : Recombinant Zebrafish sod1 Protein (1-154aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Zebrafish
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 1-154 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 37.1 kDa
AA Sequence : MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDK
THGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGN
AGGRLACGVIGITQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name sod1 superoxide dismutase 1, soluble [ Danio rerio (zebrafish) ]
Official Symbol sod1
Synonyms ZSOD; cuzn; Cu/Zn-SOD; sod1
Gene ID 30553
mRNA Refseq NM_131294.1
Protein Refseq NP_571369.1
UniProt ID O73872

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All sod1 Products

Required fields are marked with *

My Review for All sod1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon