Recombinant Cynomolgus monkey TNFRSF9 Protein
Cat.No. : | TNFRSF9-579C |
Product Overview : | Recombinant Cynomolgus monkey TNFRSF9 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Protein Length : | 254 |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB. |
Form : | Lyophilized |
Molecular Mass : | 19.2 kDa |
AA Sequence : | MGNSCYNIVATLLLVLNFERTRSLQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQIIFFLALTSTVVLFLLFFLVLRFSVVKRSRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | TNFRSF9 tumor necrosis factor receptor superfamily, member 9 [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | TNFRSF9 |
Synonyms | TNFRSF9; tumor necrosis factor receptor superfamily, member 9; tumor necrosis factor receptor superfamily member 9; |
Gene ID | 708281 |
mRNA Refseq | NM_001266128 |
Protein Refseq | NP_001253057 |
UniProt ID | A0A2K6CFS1 |
◆ Recombinant Proteins | ||
TNFRSF9-1508R | Recombinant Rhesus Monkey TNFRSF9 Protein | +Inquiry |
TNFRSF9-1233C | Recombinant Cynomolgus/Rhesus macaque TNFRSF9 protein, His-tagged | +Inquiry |
Tnfrsf9-635MAF647 | Recombinant Mouse Tnfrsf9 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
RFL2231MF | Recombinant Full Length Mouse Tumor Necrosis Factor Receptor Superfamily Member 9(Tnfrsf9) Protein, His-Tagged | +Inquiry |
TNFRSF9-1510R | Recombinant Rhesus Monkey TNFRSF9 Protein, hIgG4-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF9-1792MCL | Recombinant Mouse TNFRSF9 cell lysate | +Inquiry |
TNFRSF9-928CCL | Recombinant Canine TNFRSF9 cell lysate | +Inquiry |
TNFRSF9-2162HCL | Recombinant Human TNFRSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF9 Products
Required fields are marked with *
My Review for All TNFRSF9 Products
Required fields are marked with *
0
Inquiry Basket