Recombinant Cynomolgus monkey TIGIT Protein, Fc-tagged

• Cat.No.: TIGIT-726C
• Product Overview: Recombinant Cynomolgus monkey TIGIT protein with Fc tag was expressed in HEK293.

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: Fc
• ProteinLength: 312
• Description: This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
• Form: Lyophilized
• Molecular Mass: 40 kDa
• AA Sequence: MAFLVAPPMQFVYLLKTLCVFNMVFAKLGFSETVFSHRLSFTVLSAVGYFRWQKRPHLLPVSPLGRSMRWCLFLIWAQGLRQAPLASGMMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPLLGAMAMMLVVICIAVIVVVVLARKKKSLRIHSVESGLQRKSTGQEEQIPSAPSPPGSCVQAEAAPAGLCGEQQGDDCAELHDYFNVLSYRSLGSCSFFTETG
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: TIGIT T cell immunoreceptor with Ig and ITIM domains [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: TIGIT
• Synonyms: TIGIT; T cell immunoreceptor with Ig and ITIM domains; T-cell immunoreceptor with Ig and ITIM domains; T-cell immunoreceptor with Ig and ITIM domain protein
• Gene ID: 710941
• mRNA Refseq: XM_015129816
• Protein Refseq: XP_014985302
• UniProt ID: A0A5F8AKQ5