Recombinant Human TIGIT Protein

Cat.No. : TIGIT-163H
Product Overview : Recombinant Human TIGIT was produced in E. coli.
Availability April 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
Form : Liquid. In 50 mM Tris-HCl pH7.5, 200 mM NaCl
Molecular Mass : (Theoretical molecular weight)~13kDa
AA sequence : HHHHHHSSGLVPRGSHMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE
Purity : >90% as determined by SEC-HPLC
Storage : Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Concentration : 2 mg/ml
Gene Name TIGIT T cell immunoreceptor with Ig and ITIM domains [ Homo sapiens ]
Official Symbol TIGIT
Synonyms TIGIT; T cell immunoreceptor with Ig and ITIM domains; V set and immunoglobulin domain containing 9 , V set and transmembrane domain containing 3 , VSIG9, VSTM3; T-cell immunoreceptor with Ig and ITIM domains; DKFZp667A205; FLJ39873; V-set and transmembrane domain containing 3; V-set and immunoglobulin domain containing 9; Washington University cell adhesion molecule; V-set and transmembrane domain-containing protein 3; V-set and immunoglobulin domain-containing protein 9; VSIG9; VSTM3; WUCAM;
Gene ID 201633
mRNA Refseq NM_173799
Protein Refseq NP_776160
MIM 612859
UniProt ID Q495A1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TIGIT Products

Required fields are marked with *

My Review for All TIGIT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon