Recombinant Cynomolgus monkey SNCA protein, His-SUMO-tagged

Cat.No. : SNCA-3389M
Product Overview : Recombinant Cynomolgus monkey SNCA protein(XP_005555479.1)(1-140aa), fused to His-SUMO-tag at N-terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : E.coli
Tag : His&SUMO
Protein Length : 1-140aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 30.5 kDa
AA Sequence : MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name SNCA synuclein alpha [ Macaca fascicularis (crab-eating macaque) ]
Official Symbol SNCA
Synonyms SNCA; Alpha-synuclein
Gene ID 102119369
mRNA Refseq XM_005555422.2
Protein Refseq XP_005555479.1
UniProt ID P61142

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SNCA Products

Required fields are marked with *

My Review for All SNCA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon