Recombinant Cynomolgus monkey SNCA protein, His-SUMO-tagged

• Cat.No.: SNCA-3389M
• Product Overview: Recombinant Cynomolgus monkey SNCA protein(XP_005555479.1)(1-140aa), fused to His-SUMO-tag at N-terminus, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Cynomolgus monkey
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.5 kDa
• Protein length: 1-140aa
• AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: SNCA synuclein alpha [ Macaca fascicularis (crab-eating macaque) ]
• Official Symbol: SNCA
• Synonyms: SNCA; Alpha-synuclein
• Gene ID: 102119369
• mRNA Refseq: XM_005555422.2
• Protein Refseq: XP_005555479.1
• UniProt ID: P61142