Recombinant Cynomolgus monkey SNCA protein, His-SUMO-tagged
Cat.No. : | SNCA-3389M |
Product Overview : | Recombinant Cynomolgus monkey SNCA protein(XP_005555479.1)(1-140aa), fused to His-SUMO-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-140aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.5 kDa |
AA Sequence : | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SNCA synuclein alpha [ Macaca fascicularis (crab-eating macaque) ] |
Official Symbol | SNCA |
Synonyms | SNCA; Alpha-synuclein |
Gene ID | 102119369 |
mRNA Refseq | XM_005555422.2 |
Protein Refseq | XP_005555479.1 |
UniProt ID | P61142 |
◆ Recombinant Proteins | ||
SNCA-5869P | Recombinant Pig SNCA protein | +Inquiry |
SNCA-035H | Recombinant Human synuclein, alpha Protein, Tag Free, Fluor 488 Labeled | +Inquiry |
SNCA-01H | Active Recombinant Human SNCA Protein | +Inquiry |
SNCA-5970H | Recombinant Human SNCA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Snca-5826M | Active Recombinant Mouse Snca protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SNCA-27341TH | Native Human SNCA | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
SNCA-27342TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *
0
Inquiry Basket