Recombinant Cynomolgus Monkey IL17A Protein

• Cat.No.: IL17A-001C
• Product Overview: Recombinant cynomolgus monkey IL17A protein without tag was produced in yeast.

Specification

• Species: Cynomolgus
• Source: Yeast
• Tag: Non
• Description: IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. Il-17 induces the production of many other cytokines (IL-6, G-CSF, GM-CSF, IL-1beta, TGF-beta, and TNF-alpha), chemokines, including IL-8 (CXCL8), GRO-alpha (CXCL1) and MCP-1 (CCL2) and prostaglandins from many cell types (fibroblasts, endothelial cells, epithelial cells, keratinocytes and macrophages).
• Molecular Mass: 15.1 kDa
• AA Sequence: GIAIPRNSGCPNSEDKNFPRTVMVNLNIHNRNTSTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVKADGNVDYHMNSVPIQQEILVLREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA
• Applications: Cell culture, ELISA Standard, Western Blot Control

Gene Information

• Gene Name: IL17A interleukin 17A [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: IL17A
• Synonyms: IL17A; interleukin 17A; interleukin-17A
• Gene ID: 708123
• mRNA Refseq: XM_001106391
• Protein Refseq: XP_001106391
• UniProt ID: F6T3G5