Recombinant Cynomolgus monkey HAVCR2 Protein, Fc-tagged

• Cat.No.: HAVCR2-734C
• Product Overview: Recombinant Cynomolgus monkey HAVCR2 protein with Fc tag was expressed in HEK293.

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: Fc
• Protein Length: 302
• Description: The protein encoded by this gene belongs to the immunoglobulin superfamily, and TIM family of proteins. CD4-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas, Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. This protein is a Th1-specific cell surface protein that regulates macrophage activation, and inhibits Th1-mediated auto- and alloimmune responses, and promotes immunological tolerance.
• Form: Lyophilized
• Molecular Mass: 45.8 kDa
• AA Sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRDSGATIRTAIYIAAGISAGLALALIFGALIFKWYSHSKEKTQNLSLISLANIPPSGLANAVAEGIRSEENIYTIEEDVYEVEEPNEYYCYVSSGQQPSQPLGCRVAMP
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: HAVCR2 hepatitis A virus cellular receptor 2 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: HAVCR2
• Synonyms: HAVCR2; hepatitis A virus cellular receptor 2; Tim-3; hepatitis A virus cellular receptor 2; T-cell immunoglobulin mucin receptor 3
• Gene ID: 714891
• mRNA Refseq: XM_015141316
• Protein Refseq: XP_014996802
• UniProt ID: F7GB92