Recombinant Cynomolgus monkey CD274 Protein
Cat.No. : | CD274-706C |
Product Overview : | Recombinant Cynomolgus monkey CD274 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Protein Length : | 290 |
Description : | This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized |
Molecular Mass : | 27.1 kDa |
AA Sequence : | MRIFAVFIFTIYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNERTHLVILGAIFLLLGVALTFIFYLRKGRMMDMKKCGIRVTNSKKQRDTQLEET |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD274 CD274 molecule [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | CD274 |
Synonyms | CD274; CD274 molecule; programmed cell death 1 ligand 1; programmed cell death ligand 1; |
Gene ID | 716043 |
mRNA Refseq | NM_001083889 |
Protein Refseq | NP_001077358 |
UniProt ID | A0A5F8A285 |
◆ Recombinant Proteins | ||
CD274-3309H | Recombinant Human CD274 protein, His-tagged | +Inquiry |
CD274-020HF | Active Recombinant Human CD274 Protein, hFc-tagged, FITC conjugated | +Inquiry |
CD274-167CAF555 | Recombinant Monkey CD274 Protein, hFc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD274-178HP | Recombinant Human CD274 protein, Fc-tagged, R-PE labeled | +Inquiry |
Cd274-821M | Active Recombinant Mouse Cd274 protein(Met1-His239), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD274-2642MCL | Recombinant Mouse CD274 cell lysate | +Inquiry |
CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD274 Products
Required fields are marked with *
My Review for All CD274 Products
Required fields are marked with *
0
Inquiry Basket