Recombinant Cynomolgus ANGPTL4(Pro166-Ser406) Protein, N-10*His-tagged

• Cat.No.: ANGPTL4-129C
• Product Overview: Recombinant Cynomolgus ANGPTL4(Pro166-Ser406) Protein, fused with His tag, was expressed in HEK293.

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: His
• Protein Length: Pro166-Ser406
• Form: Lyophilized from PBS, pH 7.4, 5% Trehalose, 5% Mannitol.
• Molecular Mass: The protein has a calculated MW of 27.9 kDa.
• AA Sequence: HHHHHHPEMAQPVDSAHNASRLHRLPRDCQELFEDGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPQGEFWLGLEKVHSITGDRNSRLAVQLQDWDGNAESLQFSVHLGGEDTAYSLQLTEPVASQLGATTVPPSSLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQELKKGIFWKTWRGRYYPLQATTMLIQPTAAEAAS
• Endotoxin: < 1EU/ug by LAL.
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.5 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.