Recombinant Crotalus Adamanteus SVTLE Protein (25-262 aa), His-SUMO-tagged

• Cat.No.: SVTLE-984C
• Product Overview: Recombinant Crotalus Adamanteus (Eastern diamondback rattlesnake) SVTLE Protein (25-262 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Crotalus Adamanteus
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 25-262 aa
• Description: Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA). Shows both kinin-releasing and coagulant activities.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 42.8 kDa
• AA Sequence: VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• UniProt ID: F8S114