Recombinant Cricetulus griseus C-C motif chemokine Protein, His-SUMO-tagged
Cat.No. : | CC-1154C |
Product Overview : | Recombinant Cricetulus griseus C-C motif chemokine Protein (25-143aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cricetulus griseus |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 25-143 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 29.3 kDa |
AA Sequence : | QPDAVNSPLTCCYSFTAKRIPEKRLESYKRITSSKCPKEAVIFITKLKREICADPKQDWVQTYTKKLDQS QAKSEAATVYKTAPLNANLTHESAVNASTTAFPTTDLRTSVRVTSMTVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | C-C motif chemokine |
Official Symbol | C-C motif chemokine |
Synonyms | C-C motif chemokine; I79_001071; C-C motif chemokine 2; LOC100763833 |
UniProt ID | G3GTT2 |
◆ Recombinant Proteins | ||
Spike-30S | Recombinant SARS-CoV-2 Spike Trimer (S1+S2) (K417T, E484K, N501Y), C-His-tagged | +Inquiry |
DPY19L2-4158HF | Recombinant Full Length Human DPY19L2 Protein, GST-tagged | +Inquiry |
CDC42SE2-402H | Recombinant Human CDC42SE2 Protein, His-tagged | +Inquiry |
PF4-659HFL | Active Recombinant Full Length Human PF4 Protein, C-Flag-tagged | +Inquiry |
NOG1-8619Z | Recombinant Zebrafish NOG1 | +Inquiry |
◆ Native Proteins | ||
Factor XIII-67H | Native Human Factor XIII | +Inquiry |
MB-237C | Native Dog Myoglobin | +Inquiry |
CA72-4-160H | Native Human Cancer Antigen 72-4 | +Inquiry |
PTI-29B | Active Native Bovine Aprotinin | +Inquiry |
Elastase-26P | Native Pseudomonas Aeruginosa Elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBS1L-5617HCL | Recombinant Human HBS1L 293 Cell Lysate | +Inquiry |
VAMP8-434HCL | Recombinant Human VAMP8 293 Cell Lysate | +Inquiry |
SIX1-1825HCL | Recombinant Human SIX1 293 Cell Lysate | +Inquiry |
TFDP3-1130HCL | Recombinant Human TFDP3 293 Cell Lysate | +Inquiry |
RIPPLY1-544HCL | Recombinant Human RIPPLY1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C-C motif chemokine Products
Required fields are marked with *
My Review for All C-C motif chemokine Products
Required fields are marked with *
0
Inquiry Basket