Recombinant Cricetulus griseus C-C motif chemokine Protein, His-SUMO-tagged

Cat.No. : CC-1154C
Product Overview : Recombinant Cricetulus griseus C-C motif chemokine Protein (25-143aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cricetulus griseus
Source : E.coli
Tag : His&SUMO
ProteinLength : 25-143 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 29.3 kDa
AA Sequence : QPDAVNSPLTCCYSFTAKRIPEKRLESYKRITSSKCPKEAVIFITKLKREICADPKQDWVQTYTKKLDQS
QAKSEAATVYKTAPLNANLTHESAVNASTTAFPTTDLRTSVRVTSMTVN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name C-C motif chemokine
Official Symbol C-C motif chemokine
Synonyms C-C motif chemokine; I79_001071; C-C motif chemokine 2; LOC100763833
UniProt ID G3GTT2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C-C motif chemokine Products

Required fields are marked with *

My Review for All C-C motif chemokine Products

Required fields are marked with *

0

Inquiry Basket

cartIcon