Recombinant CPI protein, His-tagged
Cat.No. : | CPI-115 |
Product Overview : | Recombinant CPI was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Tag : | His |
AA Sequence : | MMSVKGVLLVPFLSLFGVVVLVNCLGHGNMESEARVVGGWQERSPDDNEIQEMLPSILTKVNQQSNDAYHLMPIK VLKVSSQVVAGMKYKMEIQAARSDCKKSSNEKIDLKTCKKLEGHPDQZ |
◆ Native Proteins | ||
Lipoproteins-13H | Natve Human Lipoproteins, Very Low Density | +Inquiry |
C7-102H | Active Native Human C7 Protein | +Inquiry |
Lectin-1773E | Active Native Erythrina Cristagalli Lectin Protein, Biotinylated | +Inquiry |
Kidney-003H | Human Kidney Lysate, Total Protein | +Inquiry |
Myh2-13R | Active Native Rabbit Myosin II Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ULK4-1884HCL | Recombinant Human ULK4 cell lysate | +Inquiry |
S100A8-685HCL | Recombinant Human S100A8 cell lysate | +Inquiry |
SF1-1922HCL | Recombinant Human SF1 293 Cell Lysate | +Inquiry |
FKBP9L-6201HCL | Recombinant Human FKBP9L 293 Cell Lysate | +Inquiry |
SPA17-1552HCL | Recombinant Human SPA17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CPI Products
Required fields are marked with *
My Review for All CPI Products
Required fields are marked with *
0
Inquiry Basket