Recombinant Coxiella burnetii (strain RSA 493 / Nine Mile phase I) CBU protein, GST-tagged

• Cat.No.: CBU-632C
• Product Overview: Recombinant Coxiella burnetii (strain RSA 493 / Nine Mile phase I) CBU protein(Q83AM0)(1-199aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Coxiella Burnetii
• Source: E.coli
• Tag: GST
• ProteinLength: 1-199a.a.
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 49.0 kDa
• AASequence: MRNDDDTHSTLTSSSEQVSESKIVPKDSQKPSDPNVHQNGTDVTDSAKQNASLKEVTVVTLPPDLKALEGDTHPTPMPSSREVLFNPNVHKNGTPLTHSVDPNGLSKDDEVTIVALESESKALEKELKKKGINYFKIGKTIANVAYTASLCLVFYKLSAPRGVADGVISALVNAPSAAIFFDQFFGKVLINYNPKRVTK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.