Recombinant COVID-19 nsp9 Protein(1-113aa), hFc-Flag-tagged

• Cat.No.: nsp9-3011V
• Product Overview: Recombinant COVID-19 nsp9 Protein(1-113aa)(P0DTD1), fused with C-terminal hFc and Flag tag, was expressed in HEK293.

Specification

• Species: Sars-CoV-2
• Source: HEK293
• Tag: Fc&Flag
• Protein Length: 1-113aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.5 kDa
• AA Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.