Recombinant COVID-19 E & M Protein((1-16)+(2-19)+(72-79)), His-SUMO-tagged

• Cat.No.: E & M-0912V
• Product Overview: Recombinant COVID-19 E & M Protein(P0DTC4(1-16)+P0DTC5(2-19)+P0DTC5(72-79)), fused with N-terminal His and SUMO tag, was expressed in E. coli.

Specification

• Species: COVID-19
• Source: E.coli
• Tag: N-His-SUMO
• ProteinLength: (1-16)+(2-19)+(72-79)
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.6 kDa
• AA Sequence: MYSFVSEETGTLIVNSADSNGTITVEELKKLLEQRINWITGG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.