Recombinant Clostridium fliA protein

Cat.No. : fliA-324C
Product Overview : Recombinant Clostridium fliA protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Clostridium
Source : E.coli
Tag : Non
Protein Length : 302
Description : Flagellin protein FliA(H), also named RNA polymerase sigma factor for flagellar operon, Sigma F and Sigma-28, is belonging to the sigma-70 factor family or FliA subfamily. Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor controls the expression of flagella-related genes. May regulate the expression of genes involved in virulence.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Molecular Mass : Approximately 33.1 kDa, a single non-glycosylated polypeptide chain containing 302 amino acids.
AA Sequence : MKGLKTGWIEKSVENIKTAYGIEPTGANKLKVTISDDGAYGVLASVTPKTGEFELHIDSSDFEKGDGESGNNIHGKLYDDRIIQHEMTHAVMNDALGIDKMNDLHDKNKLWFIEGTAEAMAGADERVKDIIGNDTQTGIDNTKLSKLATRADALLNGVSWNSSDEDYAAGYLMVKYIASKGIDLKAVMKEIKNTGASGLDNKIDLTNLKIDFKNNLENYIKDISKVHLDWDDDEKDVGSILGSDHGHGDIKAEDVVKGTTPEKEQPLDKFKIIWPDDNSDNTTGKIQLQVGANEGQSITILE
Endotoxin : Less than 0.1 EU/μg of rFliAH as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name fliA
Official Symbol fliA
Synonyms Flagellin protein; Flagellin
Gene ID 5400608
Protein Refseq YP_001388355.1
UniProt ID Q8RR94

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All fliA Products

Required fields are marked with *

My Review for All fliA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon